PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_17595.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 163aa    MW: 18929.7 Da    PI: 9.573
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_17595.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.73.4e-51171412128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                               pGfrFhPtdeel+ +yL++kve+k+++l e ik+vdiyk++PwdLp+  + +ekewyfF+ r +ky+++ r+nr+t sg+Wkatg
  Rsa1.0_17595.1_g00001.1  17 LPGFRFHPTDEELLEYYLRRKVENKPIKL-ELIKQVDIYKYDPWDLPRVSSVGEKEWYFFCMRGRKYRNSVRPNRVTGSGFWKATG 101
                              59***************************.99***************7777799******************************** PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               dk+v+s +   vglkk+Lv+y g+a kg+ktdW+mhe+rl
  Rsa1.0_17595.1_g00001.1 102 IDKPVYS-NLDCVGLKKSLVYYLGSAGKGTKTDWMMHEFRL 141
                              *******.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-5516150IPR003441NAC domain
PROSITE profilePS5100549.62816163IPR003441NAC domain
PfamPF023652.9E-2618141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MSGEGSKGHQ EEDETKLPGF RFHPTDEELL EYYLRRKVEN KPIKLELIKQ VDIYKYDPWD  60
LPRVSSVGEK EWYFFCMRGR KYRNSVRPNR VTGSGFWKAT GIDKPVYSNL DCVGLKKSLV  120
YYLGSAGKGT KTDWMMHEFR LPSTTKTDLS VQQAVSSISL KYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-5081528156NAC domain-containing protein 19
3swm_B1e-5081528156NAC domain-containing protein 19
3swm_C1e-5081528156NAC domain-containing protein 19
3swm_D1e-5081528156NAC domain-containing protein 19
3swp_A1e-5081528156NAC domain-containing protein 19
3swp_B1e-5081528156NAC domain-containing protein 19
3swp_C1e-5081528156NAC domain-containing protein 19
3swp_D1e-5081528156NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756690.0KM975669.1 Brassica napus NAC transcription factor 42.1 (NAC42.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001303030.11e-107transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK551e-102NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A078IW821e-107A0A078IW82_BRANA; BnaC04g52880D protein
TrEMBLA0A0B5KN571e-107A0A0B5KN57_BRANA; NAC transcription factor 42.1
STRINGBra004736.1-P1e-106(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-104NAC domain containing protein 42